PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G059300.1.p
Common NamePRUPE_ppa007697mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 359aa    MW: 38683.5 Da    PI: 8.3879
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G059300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.72.7e-13114158347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ Iar   ++Rt+ q+ s+ qky
  Prupe.3G059300.1.p 114 PWTEEEHRMFLIGLQKLGKGDWRGIARNYVTTRTPTQVASHAQKY 158
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576135No hitNo description
PROSITE profilePS5129420.266107163IPR017930Myb domain
SuperFamilySSF466892.23E-17109164IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-18110162IPR006447Myb domain, plants
SMARTSM007172.5E-10111161IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-11111157IPR009057Homeodomain-like
PfamPF002498.1E-11114158IPR001005SANT/Myb domain
CDDcd001675.44E-9114159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RVGSSSSSSA GGGGCGGLKL FGVRLTDGSI IKKSASMGNL  60
SSAAHYHSSS PNPDSPSSDP LHDPVHVPEG YLSDDPAHAS SSANRRGDRK KGTPWTEEEH  120
RMFLIGLQKL GKGDWRGIAR NYVTTRTPTQ VASHAQKYFI RQSNATRRKR RSSLFDMVPD  180
MAMDPPPVPE EQVFLPSCPE EESEAASSLP SLNLSLSSEC KPMETTHEEK VKEPDHEPVM  240
GSNGFPPMIP GFFPAYLPYP FPVWPPSAGP MRELKGGEAS HQQVLRPIPI LRKEPVNVDA  300
LVGMSQLSLG DTQRGHKEPS PLSLKLLGEP SRQSAFHPNA PAGEPDLSKG KSSAIQAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.203170.0fruit| shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4279830.0KC427983.1 Prunus domestica cultivar Stanley MYB transcription factor 3 (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007215594.10.0hypothetical protein PRUPE_ppa007697mg
TrEMBLM5X5I70.0M5X5I7_PRUPE; Uncharacterized protein
STRINGGLYMA13G43120.11e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.12e-95MYB_related family protein